PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G017900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 224aa    MW: 25517.6 Da    PI: 9.6077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G017900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W+++Ed++l+d+++ +G g+W++ ++  g++R+ k+c++rw +yl
  Aqcoe3G017900.1.p 14 KGAWSKQEDDKLIDYIQAHGEGCWRSLPQAAGLNRCHKSCRLRWINYL 61
                       79********************************************97 PP

2Myb_DNA-binding51.91.7e-1668112248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        g++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w++yl
  Aqcoe3G017900.1.p  68 GNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSYL 112
                        78899****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-22664IPR009057Homeodomain-like
PROSITE profilePS5129416.765961IPR017930Myb domain
SuperFamilySSF466898.07E-2911108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002498.2E-151461IPR001005SANT/Myb domain
CDDcd001671.16E-81661No hitNo description
PROSITE profilePS5129426.62962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2565117IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1568112IPR001005SANT/Myb domain
CDDcd001673.14E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MRQSSHCRKQ DKNKGAWSKQ EDDKLIDYIQ AHGEGCWRSL PQAAGLNRCH KSCRLRWINY  60
LRPDLKHGNF AEDEEDLIIK LHALLGNRWS LIAGRLPGRT DNEVKNYWNS YLKRKLINMG  120
IDPKNHRLSQ TRTLHPFSQV TEATSATSST GSRKYTWLQP TQPVANNRQE DDTSILPNLN  180
LDLTMAIPSP SLTYSEEVQQ HEDSKTAHLS FGPRHSNGSK SVM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315890.25e-91hypothetical protein POPTR_0010s12420g
SwissprotQ9SZP11e-72MYB4_ARATH; Transcription repressor MYB4
TrEMBLH9XUG22e-99H9XUG2_9MAGN; R2R3-MYB transcription factor MYB12
STRINGVIT_01s0011g04760.t012e-90(Vitis vinifera)
STRINGPOPTR_0010s12420.12e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-71myb domain protein 4